PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13158s0194.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 235aa    MW: 27585.7 Da    PI: 4.9152
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13158s0194.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.4e-173283556
                          SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           +f+++q++ Le  Fe++  +  +++ + A++lgL+ rqV +WFqN+Ra++k
  Bostr.13158s0194.1.p 32 KRFSEDQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 83
                          68*************************************************9 PP

2HD-ZIP_I/II117.86.1e-3830121293
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           +++r+s++q+k+LE  Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEk+y+ L+++y++l+++ e ++ke+++L +e
  Bostr.13158s0194.1.p  30 NQKRFSEDQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNILRANYNNLASQFEIMKKEKQALVSE 118
                           589*************************************************************************************9 PP

           HD-ZIP_I/II  91 lke 93 
                           l++
  Bostr.13158s0194.1.p 119 LQR 121
                           986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-17987IPR009057Homeodomain-like
SMARTSM003899.4E-132289IPR001356Homeobox domain
PROSITE profilePS5007116.3582585IPR001356Homeobox domain
CDDcd000861.51E-123186No hitNo description
PfamPF000461.2E-143283IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-173292IPR009057Homeodomain-like
PRINTSPR000312.7E-55665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000312.7E-56581IPR000047Helix-turn-helix motif
PfamPF021837.2E-1685126IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEEGDFFDCC FSEINSGMTM NKKKMKKSYN QKRFSEDQIK SLELIFESET RLEPRKKVQV  60
ARELGLQPRQ VAIWFQNKRA RWKTKQLEKE YNILRANYNN LASQFEIMKK EKQALVSELQ  120
RLKEEMHKPE EERHHERCGE QGMALSSSTE SHNGKCEPEV RLNQGIVLCN DGDNNNIKTE  180
YFGFEEETDH ELMNIVEQPD DSCLTSSDNW GGFNSDSLLD QSSSNYPNWW EFWS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00013PBMTransfer from AT3G61890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0598280.0AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds.
GenBankAY0871870.0AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence.
GenBankBT0022060.0BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413333.11e-141PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotQ9M2761e-137ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBLR0H5X01e-136R0H5X0_9BRAS; Uncharacterized protein
STRINGAT3G61890.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.11e-135homeobox 12